SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000005836 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000005836
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily Histone-fold 7.94e-48
Family Nucleosome core histones 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000005836
Sequence length 130
Comment (Takifugu rubripes)
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKAKAARDT
Download sequence
Identical sequences H2S0B5
31033.ENSTRUP00000005836 31033.ENSTRUP00000007879 31033.ENSTRUP00000044339 ENSTRUP00000005837 ENSTRUP00000007836 ENSTRUP00000007880 ENSTRUP00000044340 ENSTRUP00000005836 ENSTRUP00000007835 ENSTRUP00000007879 ENSTRUP00000023014 ENSTRUP00000044339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]