SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000007075 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000007075
Domain Number 1 Region: 276-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-60
Family SPRY domain 0.00000961
Further Details:      
 
Domain Number 2 Region: 82-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-16
Family B-box zinc-binding domain 0.00064
Further Details:      
 
Domain Number 3 Region: 10-59
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000116
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000007075
Sequence length 464
Comment (Takifugu rubripes)
Sequence
MSSPGCLLTEDQLLCDVCLDVFSDPVTLPCGHSFCRACVEQHWEDSVQRHCPTCKETFYG
PLELQSHLKPHLSVSRLKQHQLTDPMENLEWRICPKHEKPLELFCRTDQTCVCMLCPVHD
HKSHDIGRLKDQYESKRAELERQEEEIQEMIQERRRVVLNIRHAIKLSRGAAQREMANGV
QVFATLKRSLRRAEAELVGTIEERQKTAETQAKNFIQELEQELSELLTQQVEVEQLLDTK
DHLHFLQNLRTLKSSSTKDWTAVSVNLPSHEGTLSNHLRQFSVDVTLDPDTAHSALLLSE
DGKRVHHGVRRRNLLDNPERFDPCCCVLARQAFSSGSFYFEVQVHGKSRWTVGVAKASIQ
RKGVVPLCPANGHWSVWLKNGTQYAALVGTPRPLTLRSTPRRVGVFVDFDKGLVSFYDGD
TAAVLFSFTGCSFTEKLLPFFSPGINDDGKNSTPLVILNSTESR
Download sequence
Identical sequences H2S3V3
ENSTRUP00000007075 ENSTRUP00000007075 31033.ENSTRUP00000007075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]