SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000007533 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000007533
Domain Number 1 Region: 627-777
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-32
Family MAM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 781-939
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-29
Family MAM domain 0.00065
Further Details:      
 
Domain Number 3 Region: 245-407
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.18e-26
Family MAM domain 0.013
Further Details:      
 
Domain Number 4 Region: 943-1114
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-23
Family MAM domain 0.0023
Further Details:      
 
Domain Number 5 Region: 32-198
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.64e-23
Family MAM domain 0.0013
Further Details:      
 
Domain Number 6 Region: 205-241
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 7 Region: 472-618
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000285
Family MAM domain 0.027
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000007533
Domain Number - Region: 443-470
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00157
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000007533
Sequence length 1116
Comment (Takifugu rubripes)
Sequence
RQNLEEKCNFVCQASDCSDENDCGEQGYSGKDFKCDFEDAGMCGWQDTSLNAAVYSWERR
QRGETLPDSGPSSDYTTGTATGSFVGVSEVNSQHGSTAVLISPTMRESSATCRLRLRYFL
WDSGQTGLGSTPLWASIVYPDATEAVVWRPEATSIRAWREGNIFLGRIPTAFQIRFHSQR
SLGQTGDVAIDQLEFLDCALPSPGGECPAGTMRCINEVCVEERLVCDGTDDCGDGTDELS
CGSAGGLCNFDEGLCEWNLLTLSKLKWIRTNQENISLSDPRKGPGRDHSNNSVTGHFLYV
TVPDAGLSNDWASFQSHPLEPTNSSHPCKMVMYTHQFGPRSGGLTVLVADRKIYPVWERG
GALGDVWVKAEVEIVTSSVFQIVIMAAIRDSSYGGIAIDSIRLSPDCRKASGNTLIPVFK
SIIPVLILALSIENNTLAEFPKPPKNPCVEADKMCDFTPDCAHKEDEAKCGDFSYPEGSS
GWTDTSIGSQGWDLYKNSTSKEEYLYLVEASGQQLTEAQTRTPLLGPTGPACTLSFDFAL
NVGAAGELSVRVIDSMLGLQPGLWEFIGKTGTEGEAWQQVNLTIGARKHRFQLAFEARAV
KLSPPTMIKVRNVSFLNCYARYFPLSPTGLSCNFEDDLCGWYQDNSDNFDWTLLRGMDHT
IGIGRSPTVDVWSPSLRGLSGRLISYTQPPRSTAYCLSFFYKLYGPDAGTLNVKLADKVD
FEKLLWTRSGAHGNLWHEAHCPVPAQITEFQLIFEVVRSGFDGRVAIDDVSFVNRECAIP
RMCSFEDQRCGFTSSGDVLWLHRNGHTSSSIGPRTDHTLETSMGEGFYMMARADILSAGQ
TTVLVSPVHPGNAKTECVQFWYYMGGETPGSLTLYMKLLSGRREKIFSNSLNQGDMWRHA
SGNISGGGENWQLEFEVTGAGGKDSYVAVDDILISAHPCQRQDSTCTLERGLCTWTNTQN
MNRDSLDWELTSSELEKHYPVPHEDHTLGTERGHFLFLSSSNRTAIHENAHLLSPHLPPT
KGTCLKFWAFMPHSCKKSNRPTFCLINAADSTLKVWTITGGHLKELLVVTEVGALWKRFD
INIISPEEYQIVLEGIKGASGFVALDDIEYTTGVNC
Download sequence
Identical sequences H2S561
31033.ENSTRUP00000007533 ENSTRUP00000007533 ENSTRUP00000007533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]