SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000007893 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000007893
Domain Number 1 Region: 19-113
Classification Level Classification E-value
Superfamily POZ domain 7.85e-38
Family BTB/POZ domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000007893
Sequence length 113
Comment (Takifugu rubripes)
Sequence
STDGEERIYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNE
VNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Download sequence
Identical sequences H2S671
ENSTRUP00000007893 31033.ENSTRUP00000007893 ENSTRUP00000007893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]