SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000008091 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000008091
Domain Number 1 Region: 58-280
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-71
Family Calnexin/calreticulin 0.000000063
Further Details:      
 
Domain Number 2 Region: 267-407
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.05e-57
Family P-domain of calnexin/calreticulin 0.000000194
Further Details:      
 
Domain Number 3 Region: 410-454
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000301
Family Calnexin/calreticulin 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000008091
Sequence length 624
Comment (Takifugu rubripes)
Sequence
VDRGWIWRVLLLTSLVATAIRAQDEESDVQVSDADEEEEVDVSGKDGGDENVSFQVIYKT
PVPTGDVYFVETFDDGSLERWQLSKTVKGDADEEISKYDGKWAVEQLKENRVPGDQGLVL
KSRAKHHAIAAMLARPFVFKDEPLVVQYEVNFQDGIDCGGAYIKLLSDTGSLTLEQFQDR
TPYTIMFGPDKCGEDYKLHFIFRHQNPLNKDWEEKHAKRPDVDLKKFYTDRKTHLYTLVL
NPDNSYEMFIDQSSVSHGSLLHDVVPPVNPLKEIDDPTDSKPQDWDERAKIPDPEAVKPD
DWDEDAPAKIEDPDAVKPEGWLDEESDFIPDPNAEKPEDWDEEMDGEWEAPQIPNPACET
APGCGKWKRPMINNLEYKGKWKAPLVDNPNYQGAWKPRKISNPDYFEDLQPFMMTPIKAL
GLELWSMTSDIYFDNFIITSQKEVADRWASDSWGLKKLVASANEPGIFAQLMTAAEERPW
LWIIYLLTVGLPVGLLVLFCWPKKADDGYAYKKTDLPQANVEEEEEEEEEEEGAANKEDK
EAEATEATAAAEAAEEDEDIEDDAEDLMDEEEEEEEGEEEKEEEESTAQQPLDHEVGGGG
GGGGGGATQESPKQTTRKRRARKD
Download sequence
Identical sequences H2S6R9
ENSTRUP00000008091 ENSTRUP00000008091 31033.ENSTRUP00000008091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]