SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000008742 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000008742
Domain Number 1 Region: 273-428
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.95e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000537
Further Details:      
 
Domain Number 2 Region: 429-592
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.06e-39
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000235
Further Details:      
 
Domain Number 3 Region: 146-263
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-35
Family Spermadhesin, CUB domain 0.0000231
Further Details:      
 
Domain Number 4 Region: 634-796
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-31
Family MAM domain 0.0016
Further Details:      
 
Domain Number 5 Region: 36-140
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-31
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000008742
Sequence length 944
Comment (Takifugu rubripes)
Sequence
PDCWTQHRRISAESLFSLSVLPASEPCGGYLDATNAGYITTPGYPLEYPPHQNCRWVITA
PEASQRIVLNFNPHFEIEKLDCRYDYVEIHDGNSDSADLLGKHCSNIAPAPIISSGPSIH
IKFVSDYAHQGAGFSLRYEIYKTGSDCSRNFTSPSGLIESPGFPDKYPHNLECSFIIVVP
PSMDVTLAFLTFDLENDPLPGGDGDCKYDWLEVWDGLPGVGPLIGRYCGTRVPPEIHSST
GILSLSFHTDMAVAKDGFSARYNMTHKEVSETFHCSNPFGMETGKITDDQISASSSFYDE
RWLPRQARLNFNDNGWTPNEDSNREYIQVDLHTLKVVTGIATQGAISKETQKAYYVTTFK
LEVSTNGEDWMVYRHGKNHKVFHANTDATEVVLNRIPQPVLARFVRIRPQTWKNGIALRF
ELYGCQITDAPCSELQGMLSGLLPDSQISASSMRDIHGNMGAARLVASRSGWFPNPTQPV
AGEEWLQVDLGVPKMVRGIITQGARGLEGSSSAENRAFVRKYKLAHSLNGKDWTSITDSK
TSFAKIFEGNSHYDTPEVRRFEELVAQYIRVFPERWSPAGIGMRVEILGCELPGVIRTSA
ALTPPAQAVDVEDNTYHRKSPSSSTSSTTPSLTAVCDFEQSLCGWSADPLSGVSWSLHTA
SSGSTGHGTHGTIQDLSLGSDSFSGNYLHLDAGAHIQRKRARLLSPEVAPEQGPLCLVFY
YQLQGEAQGSLRVLLRDSEQEETLLWALKGDQGSHWREGRTILPQSPKEYQVVFEGFFDH
PTRGHIRIDNIHMSSDIQLEECTQPFPALTPGITNPRPMDFGKDPLFNHKPSIDGGHVFP
GWQSSFSTPSTPDMDPPSVTLVSEKDKDNAWLYTLDPILLTIIVMSSLGVLLGAICAGLL
LYCTCSYSGLSSRSSTTLENYNFELYDGIKHKVKINQQRCCSEA
Download sequence
Identical sequences H2S8L7
31033.ENSTRUP00000008742 ENSTRUP00000008742 ENSTRUP00000008742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]