SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000009482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000009482
Domain Number 1 Region: 35-229
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-33
Family Pentraxin (pentaxin) 0.0000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000009482
Sequence length 241
Comment (Takifugu rubripes)
Sequence
FVSSVNLFHPIVKVFCTSQPPYSKNEKLEKGGGVKSLVFPSESSNSYVEMIPQSPLRLEA
FTLCMRVATELQGEREIILFAYRTQDYDELNVWRELDGRLSFYLSGEGVFFQVPQLGSLQ
SHLCFTWDSSTGAANVFMDGKKSLTKIYKKGHTIRPGGRVILGQDPDNYFGSFDAKQSLV
GEIYDVNMWDSVLPGVVIWDLFTGIRAPRGNVFDWESTQLKINGNVHVVTHELNRKTCYE
M
Download sequence
Identical sequences H2SAQ5
31033.ENSTRUP00000009482 ENSTRUP00000009482 ENSTRUP00000009482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]