SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000010508 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000010508
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-19
Family MAM domain 0.0071
Further Details:      
 
Domain Number 2 Region: 1064-1126
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000409
Family BSTI 0.082
Further Details:      
 
Domain Number 3 Region: 1453-1513
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000474
Family BSTI 0.063
Further Details:      
 
Domain Number 4 Region: 1860-1920
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000785
Family ATI-like 0.023
Further Details:      
 
Domain Number 5 Region: 679-739
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000015
Family BSTI 0.075
Further Details:      
 
Domain Number 6 Region: 300-356
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000245
Family BSTI 0.087
Further Details:      
 
Domain Number 7 Region: 1974-2010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000406
Family EGF-type module 0.0063
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000010508
Domain Number - Region: 122-170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0633
Family MAM domain 0.027
Further Details:      
 
Domain Number - Region: 204-303
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0811
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000010508
Sequence length 2072
Comment (Takifugu rubripes)
Sequence
YIYHECDNVSNGKKARLLSPLISSTSSQICVQFRYYMYGIDSDNLLRVLTKRPGGEEENW
NRTGIQSPAWLPGSVTVSKSTTEQITMVFEAQRGRTSYCDTALDNIVISEGACPCNIPPY
IVEKKYAIAGEKAQLKSPSVTPTSGCLELTFYYYLYGSSKNMEISVHTITTATTPKPSTP
KPTTPGPTTPKPSTPKPTTPGPTTPKPSTPKPTTPGPTTPKPSTPKPTTPGPTTPKPSTP
KPTTPGPTTPKPSTPKPTTPGPTTPKPSTPKPTTPGPTTPKPSTPKPTTPGPTTPKPTLA
IPCPTNSHYKPCADPCQDTCSGKPPSCSGPCSEGCVCNPGYVLSAGKCVANTSCGCKFNG
QYYENGEDFYIDNCERKCRCNAPSVTCDPFACPPMHECKLQEGDLGCYPTGSQDCVVSGD
PHYNTFDKKYFTFMGTCTYTLARSCKNNTGPWFSVEGKNEERGAPGVSYLRKLYVTVNGI
TVTLMKGRRTLVNERRVALPHTPSPLMTLSLAGQYITVQTSFGLRVRWDGNHFAQITVPS
SYHNQMCGLCGDYNGSPGNDFTKPDGSVTTNVNDFGNSWKTEEDEDDFCTDGSKPDPDCD
PALEAEVVKPDKCGKINNTTGPFKDCIRVVDPTPFFQSCVFDMCQFHGQQKVLCDQLQAY
TAACLSAGATVHQWRTPTFCPLDCPANSSYSLCVSSCPETCVGVVGPPGCADTCVEGCKC
NPGFILSNDKCVALKECGCVDTSGSYHPVGDDWYLEGCEQKCQCQSGGLIQCSNTSCKPT
TERCELQDGEYGCRPLGNGICSVSGDPHYITYDKRTHHYMGACSYTLTKPCNSSSDLPYF
TVDTQNEHRGSNKKVSYVRAVVININGVTVILGKGRTVQVNGTLVVPPITSLSGIEIYFS
GKFVVLETSFGLRVRFNGNHHADVTIPTSYSGQLCGLCGNFNNNPNDDNLKPDNTPASNT
NDLGDSWQVPDPRPDCTNGGGQEDCDDKVEEEARKPTSCGMISDPTGIFKECHSVVPPGP
YFENCVYDMCATDGQVGALCQAIESYADMCASKGVSIAWRNNTFCPLKCPPGSQYKPCVS
ACRQPTCQDPAGPGGSCDLPCVEGCVCDPGLILSGDKCVPLNECGCNDEDGQYRPVGDTW
FTNTDCTERCKCIGNHNITCEPWQCSPAQECKVVDGLLDCHSTGKGICHVAGDPHYYTFD
GIMHTFMGTCTYTLVEVCNTSMVTTFKIVAKNEERGQPQASYLRYVKVYLPGDTVVELQK
SRRVLVNGKRVRTPIEIAKAGAKVIISGAYSLLDTNFGLQVKFDGVHHLEITVPGEYFNK
LCGMCGNYNHNSSDDNLKPNKQPAKDAIELGNSWKSDGDSDSGCQPDTRPDVHPNCNEEE
EKSYEAQCAQVILSDRFRPCHSVVSAEAFLGNCVYDMCEYNGMQSTLCDNIDAYAQACKS
AGVTISWRNSTFCPIPCPTNSHYSECTPPCPPTCSDLFPLFCHLPSTTCVEGCQCDAGHV
LSDRTCVPLSECGCLDSDREYHDVGDSWLTDKCSQSCTCNVGGTITCKDFMCNENSVCEP
DKDGDNICKPSGFDKCSISGDPHYRTFDGFTHHYQGPYTYILTQGHNLQSNMPSLLVRGK
NIRRGGNRRVSFLDQVYVDVYGVNVRFLQGKAVLVNGERVSPPLSPVTGLKITMNSKEVQ
LTAAFGLTVKFDGRSRGEIILPSTYRNYVRGLCGNNDGITRNEYMKPDGTVVRNLNAFGD
SWRITDRQSDGLRSIQVPHTVHRREAETDPDPGFDTSDCSSSQIEQYNSNTQCGALSDAA
GVFKACHGTLPPQTYQEYCLFDLCAESGSEELRCASYEAYATGCQNENITLGPWRQQLGC
ALSCSANSTYSPCMTSCPASCSNLAAPSECDTTNCIEGCQCAAGFVMSEGACVPYNECGC
TFLNRYYPLKEKFVTEDCSESCECTNTGLVCQPKTCQENYVCTVYNLKRDCYKASPCLSS
PCSNGGTCEEIDNGYRCQCPKGFEGIHCDDESQDTVGGLGETQKKTKWIILIVVLVVVLV
LVIVITVVCVCKRKTPGFAKIQGESRSLPAGT
Download sequence
Identical sequences H2SDM7
ENSTRUP00000010508 ENSTRUP00000010508 31033.ENSTRUP00000010508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]