SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000010934 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000010934
Domain Number 1 Region: 22-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-60
Family Calnexin/calreticulin 0.0000714
Further Details:      
 
Domain Number 2 Region: 206-320
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 4.84e-45
Family P-domain of calnexin/calreticulin 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000010934
Sequence length 435
Comment (Takifugu rubripes)
Sequence
AMTALPLLFLAMSAASVLAEPAVYLREQFEDGADAWTSRWVESKHKSDYGKFVLTAGKFY
GDAEKDKAAGLQTSQDARFYAASSRFDDFSNQGKPLVIQFTVKHEQEIDCGGGYIKLFPS
DLNQEDMNGDSTYNIMFGPDICGPGTKKVHVIFNYKGKNHLINKDIRCKDDEYSHLYTLI
VNPDNSYEVKIDNKKVESGSLEDDWDFLPPKRIKDPEAKKPEDWDDREKIPDPDDKKPED
WDKLETIPDPDAKKPDDWDEDMDGEWEPPMVTNPEYKGEWKPKEIDNPAYKGKWIHPEID
NPEYTPDADIYKYDSFGVIGLDLWQVKSGTIFDNFLITDDPKLAEEVGNETWGKTKDAEK
KMKESQEEEERKKREDEDKMRREEAKGEDEEEDEKDEEDEEEEEEEEGKEQQLDEEEEEE
EEDEEGIDSQLKDEL
Download sequence
Identical sequences H2SEV3
ENSTRUP00000010934 31033.ENSTRUP00000010934 ENSTRUP00000010934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]