SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000010971 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000010971
Domain Number 1 Region: 54-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.69e-27
Family Laminin G-like module 0.037
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000010971
Domain Number - Region: 376-582
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.00157
Family Galactose oxidase, central domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000010971
Sequence length 664
Comment (Takifugu rubripes)
Sequence
MLAYRTLIFVWVLLAARVQSQNWRPCTDLTPLDLLTKALPNPVQGPSTQVVQSTGSRGLR
LSGTTMTSLSFPASQIFTNCDFFPAEFSLVVTLKTPRLRRKEKEFIFSVVNEESHLPLLG
LCVSGNQIHLLVTTGGGGVQRRLNFKDVGLDDDSWHTVTLAVTGPYTTLTIDCGLPVDKQ
GQSFPSALSTRGSRFFIGSRGRAKGRFSGLLRQLVLLPGSDATVKLCVNSDPSLAELSIP
HVLKSVYPSYHGHVYSYVEAEARVTLGSPPPCSGQEMGQLWFNGLRKDLHICDGLMWTTL
LQKTERLDYVEDYQDLYTSSETFDIEVFSIPFEGLFMATANRFSNLKLQSVYKWRNGSFQ
LYQNISTREARAWKHFTINSKVFIVVANSREVEPQLSVIYQWNLQQHRFLHHQTLETHSA
LDWEAFKIHNHSFLVVANHRRARDSNHNIHSVIYWWNPQTELFEENQTLSTSGAYDWEFF
SVGVYHFLVVANTFDGQTTVISSTIYIWQNGCFQPFQDIPTVGATDWETFQINGRFFLVV
ANSQRVSNHGPSLYSINSTVYELNTLTQSFISFQDLLTHSAVDWEFFTIGEENFLVVANS
HDGKSYAPNSVIYRWQGYEGFVPVHSLPTFGCKDWEEFRTEEGFFLMYSSATSRLSKVFK
LKTY
Download sequence
Identical sequences H2SEZ0
ENSTRUP00000010971 ENSTRUP00000010971 31033.ENSTRUP00000010971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]