SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000012362 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000012362
Domain Number 1 Region: 918-1226
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.66e-104
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000213
Further Details:      
 
Domain Number 2 Region: 1192-1483
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.43e-82
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000818
Further Details:      
 
Domain Number 3 Region: 14-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-38
Family MAM domain 0.00000139
Further Details:      
 
Domain Number 4 Region: 376-578
Classification Level Classification E-value
Superfamily Fibronectin type III 4.23e-28
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 274-409
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000108
Family Fibronectin type III 0.0075
Further Details:      
 
Domain Number 6 Region: 176-275
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000526
Family I set domains 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000012362
Sequence length 1486
Comment (Takifugu rubripes)
Sequence
LAYCIMNAAGEKITGDCTFEKPLAACGYSQGRDDDLDWEQASTREKPSSDPWVPTDSAFA
MVNTSGRFAGQKALLLTPQLRENDTHCVTFHYYIGGRDSSHPGHLNVYIKENNSPMGMPV
WNVSGPATRSWVQIELAVSTYWPNFYQIVFEAVTSGQRGLLAIKDIVVKGHQCMNTPHFL
TIKGVEVNAGQTASFHCTVNGRKKDNFRLWLQKQGIGGREAPMRSTKPWNNRRFIGTFDV
KNTTKGDSGRYRCIIHSEKGVGVSNYGELTIKQPPVPIAPPQLTAVGATYLWIQLNANSI
NGDGPIIEREVEYRTVSGTMYDLQPVDKTTHKIGHLDPDTEYEISVLLTRPLEGGTGAPG
PLLRAKTKCAEPMHGPRRLQVVDIQATQVTIRWEPLGYNVTRCHSYNLTVQYRSKVGGKE
ETREEVCYDTQSRDPQHTIHNLTPFTNLSVKLVLRNPEGVMESTELKVQTDEDVPGAVPL
ESFQGSAYEEKIILKWREPAQTYGIITQYEISYKAVSSFDPDLDLSNQSGKVVKLGNETT
HVFTGLYPGSTYSFTLRASTAKGYGPAIITQFTTKISAPSMPAYDQETSLNQTDSTVTVL
LKPAQSRGAPVSAYQVVVEEERPRRARGTAEILRCYPVPIHFQNATLLNSQYYFTAQFPA
TGIHSPQPFTVGDNKTYNGYWNAPLLPQKSYSIYYQAVSSANGETKIDCVRVATKAAILV
TQLTTPYLRIAPAAGDNQLTGSATHKPDAVEPEKQTDHTVKIAGVIAGILLFVIIFLGVV
LLMKKRKLAKKRKETLNSTRQEMTVMVNSMDKSYTEQGTNCDEALSFMDTHNHTLNARSD
SSPSSFSLPKANTLSTSMPTSSYYPDPFVPTAILDESQNVCSDTSSLVQSHTHSLRKREA
VDVPYQTGQLHPAIRVADLLQHITQMKCAEGYGFKEEYESFFEGQSAPWDSAKKDENRMK
NRYGNIIAYDHSRVRLQALEGEQSSDYINANYVDGYHRPNHYIATQGPMQETVFDFWKMV
WQENTAAIVMVTNLVEVGRVKCCKYWPDDTEIYRDVKVTLIETELLSEYVIRTFAVEKRG
AHEIREIRQFHFTGWPDHGVPYHATGLLGFIRRVKSKTMTNAGPMVVHCSAGAGRTGCFI
VIDIMLDMAEREGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTTIPASQ
LRSVYYDMNRLDPQTNSSPIKEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDVLPPD
RCLPFLITIDGESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSIVML
NDVDPAQLCPQYWPENGVHRHGHIQVEFVSADLEEDIISRIFRIYNAARPQDGYRMVQQF
QFLGWPMYRDTPISKRSFLKLIRQVDKWQEEYDGGEGRTVVHCLNGGGRSGTFCAISIVC
EMLQHQRSVDVFHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLSSG
Download sequence
Identical sequences H2SIY0
31033.ENSTRUP00000012362 ENSTRUP00000012362 ENSTRUP00000012362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]