SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000012665 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000012665
Domain Number 1 Region: 82-266
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.87e-28
Family Clostridium neurotoxins, the second last domain 0.013
Further Details:      
 
Domain Number 2 Region: 422-651
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000000582
Family Reprolysin-like 0.063
Further Details:      
 
Domain Number 3 Region: 1208-1284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000236
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 4 Region: 1342-1411
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000089
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 5 Region: 1403-1465
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000181
Family Complement control module/SCR domain 0.0061
Further Details:      
 
Domain Number 6 Region: 1280-1346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000278
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 7 Region: 660-700,878-933
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000583
Family Fibronectin type III 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000012665
Sequence length 1621
Comment (Takifugu rubripes)
Sequence
MKLWTSPWVFCLVILLLCFGSECGTVQRKGRSKRELVRIREAKATIPGACATRLPRGKRS
LPGLERRVLPHRRRSAQAVENSSDRGKSVYFTGRGDQLRLKPGVEIPRGNFTLEMWIKPE
GGQRSPTVIAGLYDKCFYASSDRGWLLGIEAVSEHGNRDPRFFFSLKTDRAHKATSIHSN
ARYVPNQWAHVAVTYDGVYMKLFVNGAQVGVSREQSGDVFSHLTKKCKVLMIGGNALNHN
YRGAVERVGLWRQARGQRQIIRDMQGHEDPQDLPQLVIRETFEHPGRKWLTVKDGSFPQP
EQIGNSEGLLDTMLEPPPCGQTVCDNIEVIKNYNNLWNFRRPKKVRYRVINIWDDARTRP
TVTDHQISLQHQQLNDAFSPYNITWELSIYNVTNSSLRNRLILANCDISKVGDDVCDPEC
NHPLTGYDAGDCMSGHRNRCPESKQGNGVCDPECNCENFSYDLGDCCNPNITDVTKTCFN
RSSPYKAYLDVKELKEILQLDGSTHLNVFFANSSDEDLAGVATWPWDKEALTHLGGIVLN
PSFYGTFGHTDTMVHEIGHSLGLYHVFRGISEVESCNDACLETEPSMETGDLCADTNPTP
KYKGCHDPDPGNETCGCRDFTHTPFNNYMSYADDSCTDSFTLNQVARMHCYLDLIYQTWQ
PASKPPPVPMPPQVVEQHHNSISLEWFHPISGHFYNREVGSVCDKCTEGRVLLQYATNSS
SPRPCAPSGHWSPREAEGPPDVEQACEPSVRTWSPNAGIEQGVVGLSECPLQGCMLQLEF
PYPLVPDSLTVWVTFFSPEETALPAIHNILLLTVSGNNISLGPSNVFCDTPLTLKLDTEE
EVFGVQFFTMEQHLEIDATLLASKPDCQLCRHCQPLHYRLLRHPPFTHAPHGLMLKEPTR
RYTDRDVVPHVAYTYQVQTVSGRSDSEPSPPLIHELGAPYCGDGRIQSSKGEECDDMNTV
NGDGCSSRCKKEPFFNCVEEPSMCYYYDGDGVCEDFERETGVRDCGLYTPNGFLDQWAAT
VEVSHEQKPYCSGEVAAGYPAVTKTCQSKVFDLSDGVSQYAWFPCQEAHATTMGYANYWL
KAHFSHPMVAAAVIIHLATDGTTYIDQTQCNITVRLVDTKEGIHSLGEWRLSCRNNPLVI
PVTHDLSVAFYHTKAILVTFVSRLVAISGVGLRSFQSFDPITISGCQSNEIYNPTGQSCV
HYSCEAIDCPEPLIRNADLSCSSPGRHFYNGDRCTISCHSGYVLQIHQDDDLIKSQSDSS
VTITCANGKWNKQISCEPVDCGLPDKYHVHPAHFTFPEGTTYGKKSTFQCREPAQLVGKN
NTLTCMEDGLWSFPEALCELRCLAPPPVPNAVLQTKRCNETDLKVGTLCKYKCRPGYHVT
NKSKRRAFKRQCTEDGSWLEGACEPVTCDPPPPIFHGSYHCTDGFRFDSICRLNCSDPAG
NTAAVSNVIRCRKDGNWTGSFHLCPHITGQCSLPQNLHYSLQYFCHRGHGIGEECELTCR
ENSNEVVILPSNMTVDGVLKEHWRNPHKVKSIVCTMGLKWYPHPELLHCIKGCEPFMGDN
YCDAVNNRAFCNYDGGDCCQSTVKTKKVIPFPMSCDIRDECSCRDPNAFENRKDDHVHSL
G
Download sequence
Identical sequences H2SJT2
ENSTRUP00000012665 ENSTRUP00000012665 31033.ENSTRUP00000012665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]