SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000013108 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000013108
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.45e-29
Family Galectin (animal S-lectin) 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000013108
Sequence length 134
Comment (Takifugu rubripes)
Sequence
YIGEIKGGMRPSMKLIVMGIINKKPKSIEVTLSSAPPEEDSEGDVGLQLQVNFVDKAVQR
NARLAGKWGKAENTLSFFPFAPGESFKMEIVCEHQQFRILVDGQPLCGFSHRLSRLASLT
ALRVFGDLQLTKVA
Download sequence
Identical sequences H2SL23
ENSTRUP00000013108 ENSTRUP00000013108 31033.ENSTRUP00000013108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]