SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000015333 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000015333
Domain Number 1 Region: 96-186
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.64e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 244-319
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000422
Further Details:      
 
Domain Number 3 Region: 10-84
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.36e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000015333
Sequence length 327
Comment (Takifugu rubripes)
Sequence
MEPSKIQPEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERI
VTITGPTDTIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGS
KIKEMRESTGAQVQVAGDMLPNSTERAVTISGTPEAIIQCVKQICVVMLEVCSDSPPKGA
TIPYRPKPASTPVIFSGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFTPLGQATPAFPD
SGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANAMEGSSERQITIT
GTPANISLAQYLINARLTSEVTGMGTL
Download sequence
Identical sequences H2SSE6
ENSTRUP00000015333 31033.ENSTRUP00000015333 ENSTRUP00000015333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]