SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000015746 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000015746
Domain Number 1 Region: 185-301
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-37
Family Third domain of FERM 0.00044
Further Details:      
 
Domain Number 2 Region: 84-184
Classification Level Classification E-value
Superfamily Second domain of FERM 2.49e-28
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 3 Region: 4-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.99e-23
Family First domain of FERM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000015746
Sequence length 302
Comment (Takifugu rubripes)
Sequence
KLRLRVIFLDDSERSFEVEQRVLGGDFFNKVCGHLKLLEKEYFGLEFRHHNGNYVWLELL
KPLAKQIKYTNDLFFRFIVKFFPPDPGQLKRGLTRYLFALQIKQDLSNGGLTCHDNSAAL
LVSHILQSEVGDHDEELDCHHLEMKHYVPNQEYLDHKIIKFHKRHRGMSPAQADIQLLEV
ARKLDMYGIRPHPAHDGEGMRINLAVTHSGVLVFQGNTKINTFSWAKIRKLSFKRKHFLI
KLHDKVGPSCKDTLEFSMASRDVCKSFWKTCVEYHAFFRLPEEPRSMQKTLLFSKGSSFR
YR
Download sequence
Identical sequences H2STK9
31033.ENSTRUP00000015746 ENSTRUP00000015746 ENSTRUP00000015746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]