SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000016093 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000016093
Domain Number 1 Region: 534-676
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.34e-17
Family Galacturonase 0.052
Further Details:      
 
Domain Number 2 Region: 119-216,428-619
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.11e-16
Family Pectate lyase-like 0.073
Further Details:      
 
Domain Number 3 Region: 4-85
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000157
Family F-box domain 0.0027
Further Details:      
 
Domain Number 4 Region: 730-854,891-900
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000000101
Family Pectate transeliminase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000016093
Sequence length 961
Comment (Takifugu rubripes)
Sequence
MEVGNLPVELWRIILAYLPLPDLGRCCQVCRAWRELILSLDNTRWRQLCLGCPESRHPNW
PSQPHLEPPSWREALKQHAIATRTWTQNGPELQSSACLLFLRRRKDRKVWHVGPGCELET
LRSALVVAGPYDRVVLHPGVYEEQAEIVMKVPVELLGLGQLGEVALLVCLEQQCPTARLC
NLVFMPPWFSTVVYKTSWGHVQFDNCNFEGAQLQVRGPGTCQARFCSFSQGSSAHLLGVV
LSLLDSCDFSGSDTASVTVEGPPVSERNWACKHLTSLARTFPSYRTSGNNSSPPTDLLVH
TSGGHQPLGVNVKNEHMSMEGWLHKTGVGAVCQATVIEDCWSEGECSDREEQILEGEGGY
DAKNQLNQYYRIPCDNHGLSHLLKPQKDRSPPVGSSLDPTPVAPELLTFQQELDRDPEAQ
MLAASTLGCIVKRCLFREGKGGVHLSNYGRARLEGNVFRGLNYAVRCIQNSTIVMLRNEV
CECRASGVFLRLASQGLIAENNIHGNGEAGLDIRKGANPIIVKCNRIHSGLRSGVVVLGN
GKGSLRSNWIYNNKEAGVYILFSGNPVVSGNHIFQGQAAGIAVNENGRGVITNNVIRENQ
WGGVDIRRGGDPILKNNFICYGYSDGVVVGERGRGLIEGNHVYCNKGCGVWIMSSSLPQL
LGNYITHNCMYGLAVFCRKDPENIESREGRDGQENLNEEGELFAWESDLDSEDERHSARR
SISVALVESNCLNFNGAVGLYVKSSEPLNVFANLINSNRGTGVTVLQSSQLTRLANNCIL
NNGCGGVTVEKECRAELRGNGIYKNGGHGVSFSGSGQIVENDVVGNRGCGIQISNSTDVK
VLRNRVQPARGCGMTVLGPVKGVIHDNLLFQGQTGTRRTLLQVDPGNDGCVLRNNSILTH
SNSFTSPAWVLENPPPRPLVSSPCGLSSSQCPSRLGISMTTRISATVESGCHSGSMFCSI
L
Download sequence
Identical sequences H2SUK6
ENSTRUP00000016093 31033.ENSTRUP00000016093 ENSTRUP00000016093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]