SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000016334 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000016334
Domain Number 1 Region: 360-455
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.09e-22
Family Tudor domain 0.00017
Further Details:      
 
Domain Number 2 Region: 155-233
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000497
Family Eukaryotic type KH-domain (KH-domain type I) 0.00039
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000016334
Domain Number - Region: 107-155
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000016334
Sequence length 581
Comment (Takifugu rubripes)
Sequence
MDVGVSNSHVFLNYPPRAFFSQWCIPLGARRIMNAVKDGHKSTLTSGKMVALAAGLTVGA
TVGYIIYRHVSTSKTSQGSNSEVSKMTLPIEVYRNLSRYQAKFLDVVTQKSGAHVRISLD
GGKSDCQNVSFLLQGSKEQVLLARCVLQNLVIDCEPVVEVLEVPQTAFGRIIGRGGEGLK
EMTRTTGAKVSCSKERMHIPGAMGTVTIKGTKQEVKKAKEFIIEKVKEDMIVRAKICESS
AQRQKRGHTTVGYGPEVTEREAPVGLNNNIPSSDPEKNRLIHANGTTGQPEDLTEELTST
HTDDGEEESVSTNSLSEVSKFEIPSPDLSFQPDEHLEVYVSAYENPNHFWIQILGVRSLQ
LDKLTEEMNHFYSNSSATDHGVETVIGDIVAAPYRDHQTWNRARVLSGPDSELVDLYYVD
FGDNGELPRDRLRRMRSDFLSLPFQAIECNLAGVKPKGDEWTESALDDFDRLTHCASWRP
LLAKLCSYSHSDLSSWPSVKLCDTSDGTEVDIGEELIRLGHAASFQEVVKGKTGGENSGS
LQKMLDDVMGASSELSLSCISLSEAASISESVDDIVEDELL
Download sequence
Identical sequences H2SV96
31033.ENSTRUP00000016334 ENSTRUP00000016334 ENSTRUP00000016334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]