SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000018360 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000018360
Domain Number 1 Region: 84-177
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 251-324
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.13e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00014
Further Details:      
 
Domain Number 3 Region: 4-75
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000018360
Sequence length 435
Comment (Takifugu rubripes)
Sequence
LGVTLTLRLLMHGKEVGSIIGKKGETVKRIREESSARVNISEGSCPERIITITGSTDCVF
RAFTMITHKLEEDLAALVANGTISTKPPVTLRLVIPASQCGSLIGKGGAKIKEIRESTGA
QIQVAGDLLPNSTERGVTISGNQDSVIQCVKLICTVILESPPKGATIPYRPSPSPAAVLI
AGNQLFDASEFATHPMYSVAQGGLDLQQAYTLQNQYGIPHSELAKLHQLSMQQGLNPIAQ
PASTVIPGMDSNSQTSQELLIPNDLIGSIIGRQGTKINEIRQVSGAQIKIGSQLDGTSDR
HVTITGTPVSINLAQYLITSCLETAKSTAQAATLAAPVDLNMAFTQPASPAASPTPTLAA
MGALTPAHIVSTPYGAMPLSSLMGMKSVPFLTLSSPAPSVAVTAAPSHTTLAAYTAKISS
ANCIKKPERQKFAPY
Download sequence
Identical sequences H2T122
31033.ENSTRUP00000018360 ENSTRUP00000018360 ENSTRUP00000018360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]