SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000019880 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000019880
Domain Number 1 Region: 152-220
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.05e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 511-557
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000124
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 3 Region: 79-127
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000847
Family Eukaryotic type KH-domain (KH-domain type I) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000019880
Sequence length 563
Comment (Takifugu rubripes)
Sequence
DHQEALRFALDQLSLMALEKVDGGGGGLVDSLDGKRSVNMTECVPVPSSEHVAEIVGRQG
WQPAKGGRSGFKPILLLLGCKIKALRAKTNTYIKTPVRGEEPVFIVTGRKEDVEMAKREI
VSAAEHFSMIRASRCKAGGSGGGSLPGPPHLPGQTTIQVRVPYRVVGLVVGPKGATIKRI
QQQTHTYIVTPSREKDPVFEVTGMPENVDRAREEIETHITLRTGTFVDLQGDNDFHSNGT
DVSLEGLGALSAGLGASLWSRATNHHSAPPPPPSSPPPTLPVSMHHSSNRKMSSSVAYHA
HNGMSSDGFGAGRKANEGGSPTSPFSTGSSAGGGGFTFGGDSTPGLPSSEDLGFEFSASN
IWAPFVNGGAGGKAGGSSQQQQPLRRNSSGLSGGAITPRLSPTLPQDSGAGPLDHPLARR
AQSDPLSTLSWLQSSGTGGGSFSGASSSSSGGSSTGYSSCSASSLPGGSPTDSEGGGSGV
ALTSGMLSRLKGGSGPGATGLVGVSPGINRDCFVCFESEVTAALVPCGHNLFCMECAGQI
CQSPEAECPVCHTPTTQCIRIFS
Download sequence
Identical sequences H2T5E2
ENSTRUP00000019880 31033.ENSTRUP00000019880 ENSTRUP00000019880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]