SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000019939 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000019939
Domain Number 1 Region: 85-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-32
Family Skp1 dimerisation domain-like 0.00000653
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily POZ domain 8.11e-26
Family BTB/POZ domain 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000019939
Sequence length 163
Comment (Takifugu rubripes)
Sequence
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDDGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences H2T5K0 Q4T9N8
ENSTRUP00000019939 ENSTRUP00000019939 XP_003971025.1.43653 XP_011609649.1.43653 XP_011609651.1.43653 31033.ENSTRUP00000019939 99883.ENSTNIP00000019183 ENSTNIP00000019183 ENSTNIP00000019183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]