SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000021391 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000021391
Domain Number 1 Region: 7-205
Classification Level Classification E-value
Superfamily E set domains 2.24e-76
Family RhoGDI-like 0.0000000589
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000021391
Sequence length 205
Comment (Takifugu rubripes)
Sequence
MAEQEPTPEQLAEIAAANEESEGSVNYKAPAQKSLQEIQELDKDDDSLRRYKEALLGKAS
VVTDPKLPNVHVTRMTLMCDTAPGALVLDLTGNLENIKKSTFVLKEGVDYKIKITFKVNK
EIVSGLRYTQTSTRKGVKVDKTDYMVGSYGPRPEEEYEYVTPVEEAPKGMLARGTYTIKS
KFTDDDKHDHLSWEWNLTIKKDWKD
Download sequence
Identical sequences H2T9Q1
31033.ENSTRUP00000021391 ENSTRUP00000021391 ENSTRUP00000021391 XP_003964507.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]