SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000025424 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31033.ENSTRUP00000025424
Domain Number - Region: 6-52
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0823
Family Calponin-homology domain, CH-domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000025424
Sequence length 423
Comment (Takifugu rubripes)
Sequence
MSFRELRNFTEMMRALGFPRLISMQSFRTPNFPLVAEILIWLVKRYEPTMDIPTDISTET
DRVLFIKAVAEFMANKAHIELNTKNVYKADGYAVKEMLKVTSLLFSAMKTTEAALGDRNE
EDNVKFKFNITSQTSDLKAARQLASVITSKGASLCDLLAKEVDLKESRSVAIAKPFEMNE
IEKALKAAIKEDLESLETTKDMLSKLASDEPSLDSKIEKKKQELERNQKRLRTVQSVRPA
IMDEYEKIEEELKEQYELYVKKFRILCCLESQLESYHRLEQERFEEAENKMRMMQQKLRQ
EEKDLMWSSLKDEDSDLDLPDDRDSDSDAEENRPFRPRSMKGMMAAGAGRDARVIGNMQG
GDSDESEDGEIDGHEDDDDEEEDDEVSKDLEDDSLDGPISRVPGFYVKPGMRSSMLDDSD
NDF
Download sequence
Identical sequences H2TL69
ENSTRUP00000025424 ENSTRUP00000025424 31033.ENSTRUP00000025424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]