SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000027315 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000027315
Domain Number 1 Region: 7-53
Classification Level Classification E-value
Superfamily HCP-like 0.00000000000497
Family HCP-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000027315
Sequence length 66
Comment (Takifugu rubripes)
Sequence
GLENAKSGNYEEAFICFKAASEQGYSKAQFNVGVCYEKGRGVHKDRQKVCIFYSTLKVSV
RNINHY
Download sequence
Identical sequences H2TRK8
ENSTRUP00000027315 31033.ENSTRUP00000027315 ENSTRUP00000027315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]