SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000027452 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000027452
Domain Number 1 Region: 391-620
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.77e-36
Family Calponin-homology domain, CH-domain 0.0000952
Further Details:      
 
Domain Number 2 Region: 90-244,389-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.62e-18
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.086
Further Details:      
 
Domain Number 3 Region: 700-731
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000011
Family LIM domain 0.011
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000027452
Domain Number - Region: 732-761
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00047
Family LIM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000027452
Sequence length 1154
Comment (Takifugu rubripes)
Sequence
CSPPDVSVWEQRPAAELFDEFISSSTCRTALWSFSQLCEHLQLDRHTAERPLYRSIKCCL
KYWRADALWAKLERRAAHQEYQQGGACRNTTCVIIGAGPCGLRTAVELGFMGARVVVLEK
RDSFSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLVLLKVALLLGVEV
HVHVEFKNLLEPPEDQQNLQVGWRLEVNPKSHPINHLEFDVIVGADAEMFVREGFRRKEF
RGKLAIAITANFKNRNTTAEAKVEEISGVAFIFNQRFFQELRQETGIDLENIVYYKDDTH
YFVMTAKKQNLLDKGVIAQDFADTELLLSRKNVNQSALQAYARQAADFSTNQQLPSLDFA
INHYGQPDVAMFDFTCMYASENAATVRQRHGHQLLVTLVGDSLLEPFWPMGTGIARGFLA
ALDSAWMVRRWSEGRAPLDILAERESLYRLLPQTTPENLQKNFGLYVDPTTRYVNVNQLY
VTPAQMRHLVDTGQDAGLHCSEDIIRLPSSHRFSQSNQLLRWCQEQTCGYHGVTVSDLTT
SWKSGLALCALIHRYRPHLMDFDSLDPMSVEDNTQLAFDVAEQEFGIPPLISVEEMSSAG
EPDSLSMVMYLSQFYQLFKDTPPPAERSKIPLSSCSTLSLLLCFNMLKSIQDLRDTGGKW
RTTSTGAAQQVSGTLVADEHQPSSSSASGTCQRSLSPQSSGVSQVCSVCQKRLYVMERLS
AEGFFFHRGCFQCCQCRRTLRLGNYSFNQSNRRFYCSQHCDSAPPHISPSLSSQKEKLLP
TSPSISSAAGSDITHCDTPVQPDSTSTASFVTACEGAPPTGPASPVAMATDAQKAAVLQD
EGMVSGSLVSRKRRKVGVPSLTAPLVPPFLREEEKGGNKNQQVAFPENRKEKKKCADGMV
ANQRRAAGDDVRKKHQSGDKVVGQDTSQEAPEAPVRHRYVTGSTSTSQIRHRKHQKQQEA
PEAAICDRKQQYVTDTSQEAPVSGGTPGPGQRAFQFEREGEHVPVWPRRTTGRRTKQKQL
KRLHRAQMVQRKQQQVEEKQKQLEERGVMVEKILRGGLDNPALMQYWFQLVQKKNVLVRY
EFKLMIFARELELEDQQSHLQQELRDRMTVDDRLKDEEHLLEERMILEEMLEVVEKRDAL
ASLLEDQRLQDSQA
Download sequence
Identical sequences H2TRZ4
ENSTRUP00000027452 31033.ENSTRUP00000027452 ENSTRUP00000027452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]