SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000027788 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000027788
Domain Number 1 Region: 13-106
Classification Level Classification E-value
Superfamily POZ domain 2.94e-32
Family Tetramerization domain of potassium channels 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000027788
Sequence length 237
Comment (Takifugu rubripes)
Sequence
MDNGDWGHRMTTPVTLNVGGHLYTTSLSTLQRYPDSMLGAMFRGDFPTTRDSQGNYFIDR
DGTLFRYILNFLRTSELTLPVDFTETDLLRKEADFYQIEPLIQCLNDPKPLYPPDIFEQV
VEVSSTRKLSKYSNPVAVIITQLTITTKVHGLLEGISNNFTKWNKHMMDTRDCQVSFTFG
PCDYHQEVSLRVHLLEYIMKQGFTIRNTRVHHMSERANENTVEHHWTLCRPAHKVED
Download sequence
Identical sequences H2TSY0
ENSTRUP00000027788 ENSTRUP00000027788 31033.ENSTRUP00000027788 XP_003963396.1.43653 XP_011600829.1.43653 XP_011600830.1.43653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]