SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000027824 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31033.ENSTRUP00000027824
Domain Number - Region: 4-44
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000568
Family Calponin-homology domain, CH-domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000027824
Sequence length 694
Comment (Takifugu rubripes)
Sequence
NKKAYDGFASLGISRLLEPSDMVLLAIPDKLTVMTYLYQIRAHFSGEELNVVQIEANSSR
STYKVGDFETDTNASIDQDKFYAELGDVQSRQVNSQSVAPASGESNGTKTAEDEILKADC
KADEETATLKTAGHPQSSPPVPSPRTVGFISAVDSSQATPSGPGERGSLIKANTLDLCEL
PRIVEREMEKEKEQDEVGQETSEGAEPGSPSRRGPPTSSSHHQKLGFSYNRDADLIKKKR
ASLRHSESEPVTDTNSPPVDRTDTPPQQRVLSRQEELKERARLLLEQARRDAAVKASNKN
NPNPAANAANRTTNISDERDAERRRQLRERARQLIAEARSGVKMSEVVACMQMRCRQLKI
KTDKLTEEIGTAKIVTGNDLYSTSSTQGTSGLTNTSFELASLGTNSKHVDLKLKKLVDVS
PRRVTSPSSPSSTSSSPTASSASPISNNTQELRAERLRRATERLRNPVVFNKDSAVRKTQ
LKSFSQYVENRPAEGKRQKSVPEDLSKVEDDRSSLSELDFCRTFEEEKAFKDTSQYVVGE
LSALESEQRHIDARAACVEERLRYLMDTGNNKEEEEAMMQEWFVLVNKKNALIRRQNQLS
LLEKEHDLERRFELLNRELRAMLAIEDWQKTEAQKRREQLLLDELVILVNKRDALVRDLD
AQEKEAEEEDEHLERTLEQNKGKMAKKEEKCVLQ
Download sequence
Identical sequences H2TT16
ENSTRUP00000027824 ENSTRUP00000027824 31033.ENSTRUP00000027824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]