SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000028126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000028126
Domain Number 1 Region: 31-131
Classification Level Classification E-value
Superfamily POZ domain 1.55e-29
Family Tetramerization domain of potassium channels 0.0028
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000028126
Domain Number - Region: 116-203
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 0.0222
Family MazG-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000028126
Sequence length 249
Comment (Takifugu rubripes)
Sequence
CTQDSSSSICGSPLGSGGIPTPAKLSKSNAPVHIDVGGQMYTSSLGTLTKYPESRISRLF
DGTEPIVLDRLKQHYFIDRDGHMFRYILNFLRTSKLLIPDDFKEFSLLYEEARFFQLTPL
QSQLEHWRTERECGQSCPECVVVHVAPELGERVSVSAQHAVIEEVFPEVRDVLSASLNST
HISRFPLSGCCLLNSVQVLERFQQSGFWITCSCGGGVDSSQFREYILQREGRGSKQPQAL
AHIKEEPED
Download sequence
Identical sequences H2TTW8
ENSTRUP00000028126 31033.ENSTRUP00000028126 ENSTRUP00000028126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]