SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000028843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000028843
Domain Number 1 Region: 94-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.41e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 267-340
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.04e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000485
Further Details:      
 
Domain Number 3 Region: 8-83
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000185
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000028843
Sequence length 348
Comment (Takifugu rubripes)
Sequence
MDPCVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTTAIFKAFSMIIDKLEEDISSSMTNSTATSKPPVTLRIVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGTAHSIIECVKQICVVMLESPPKGVTIPYRP
KPSGSPVIFAGGQVRSIPQKVLGHDWHPNIWNGSESASTFQAYAVQGQHAIPQPDLSKLH
QLAMQQGPFPMATCNQGFTDLLGMDASAQACSHEMTIPNDLIGCIIGRQGAKISEIRQMS
GAQIKIANPVDGSTDRQVTITGSPASIGLAEYLIKARLSSEATGLASN
Download sequence
Identical sequences H2TVY4
ENSTRUP00000028843 31033.ENSTRUP00000028843 ENSTRUP00000028843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]