SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000029553 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000029553
Domain Number 1 Region: 42-113
Classification Level Classification E-value
Superfamily Macro domain-like 1.04e-16
Family Macro domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000029553
Sequence length 114
Comment (Takifugu rubripes)
Sequence
MQMSATGRKRPLAEQDWPQWKGCTDIDRQQTVGEFGEGSWRLNYVTGDLFSCPGDEALAH
CISEDCHMGAGIALMFRKKFNGVEELKQQKKVTGQCAVLKRHKRYVYYLITKKR
Download sequence
Identical sequences H2TXZ4
31033.ENSTRUP00000029553 ENSTRUP00000029553 ENSTRUP00000029553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]