SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000030465 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000030465
Domain Number 1 Region: 63-192
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.89e-28
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000030465
Sequence length 375
Comment (Takifugu rubripes)
Sequence
IKMEDTKYLPELLAEKDSLDSSFTHAMKLISAAEIERIQKGETKKEPEKETYLDLFATKN
LKLKERVLIPTKQYPKVNFVGKLLGPQGSTIKRLQEETGAKISVLGKGSMRDKNKEEELR
KGGEAKYAHLAMELHVFIEVTAPIPEAYLRMAHAMDEVKKFLIPEPCEADPYMDPHFLNG
SQDGSVRGRGGLMGRGRGGPPGPSPTHLRRGRGMPRGGPRGAMRGGAPRGGLGRGSAPRG
APSGRGGPASAANRGGAAPRSRPPTAGAPRMLPTPSMSHQQGPAASQPKVEGYEDYPYEE
SYPETGYEGYENYYTQQPAAADTEYYDYGHGEAQETTYESYTQDEWDNSWSGAGGKAAPA
RQAKGGYRDHPYGRY
Download sequence
Identical sequences H2U0K6
31033.ENSTRUP00000030465 ENSTRUP00000030465 ENSTRUP00000030465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]