SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000031590 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000031590
Domain Number 1 Region: 154-248
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000031590
Sequence length 249
Comment (Takifugu rubripes)
Sequence
MDTDKISTTPAGETADIAHNTDSFTKVKSKKCQKRKREQDGADMDTEESVVSKRPQFPPI
SGDKLTGGPDEMRKIPVPANRYTPLKENWTKIFTAIVENLQLQVRFNLKTRNVEIKTCKE
TQDVGALTKAADFVKAFVLGFQVEDALALMRLDELFLESFDITDVKPLKGDHLSRAIGRI
AGKGGKTKFTIENVTKTRIVLADTKVHILGSFQNIKMARTAICNLILGSPPSKVYGNIRA
VASRAAERF
Download sequence
Identical sequences H2U3S9
31033.ENSTRUP00000031590 ENSTRUP00000031590 ENSTRUP00000031590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]