SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000032387 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000032387
Domain Number 1 Region: 329-613
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.39e-70
Family Tandem AAA-ATPase domain 0.0000834
Further Details:      
 
Domain Number 2 Region: 87-154
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000032387
Sequence length 667
Comment (Takifugu rubripes)
Sequence
MSDWEDASDDTGDSIRDWSRQQPSPAIDWTRTAFPSENENFGMIDARQERTDAHKAREPG
RAPAVRGRTFHRNCDPGETMGDLTRGLRFNVEKLSIGTIIGRGGARIRQMQDRSGATIKV
YTRDTQGEVNIFGSPDSQQKAKNMIDDLLANPNVSRQNGEGRTTSDWTSRAAPSAQEASA
PAAIDWGMIRKKKDKYAEIKWKGLPPIKKQFYIEAESLSALMPEEVNQWRKENNNIFVDD
LKKEGEKRPIPKPCRTFLEAFQHYTEIMDNVKHAGFVNPTPIQSQAWPVLLSGDDLIAIA
QTGTGKTLAYLLPGFIHMNGQPVPKCERNGPGMLVLTPTRELALQVDAECKKYSYKDYKS
VCVYGGGDRKAQIHKVERGVDIVIATPGRLHDLQMNKLINLRSITYLVLDEADRMLDLGF
EPQIMKILLDVRPDRQTVMTSATWPASVRRMATSYLKDPMMVYVGSLDLTAVSSVQQKIL
IVSAEEKKPYLLNFLKNMEPQDKVLIFVGRKLTADDLSSDLCLYGESVQCLHGGHEQCDR
EEALKDFKASKVRILVATDLASRGLDVLDITHVFNYDFPKNIEEYVHRVGRTGRAGRSGA
AVTLVTRDDWRMAPRLIPILERSGQDVPEELVTMAERYDKYRELRAREEIGGRRDGGRRD
GGWKGRK
Download sequence
Identical sequences H2U621
ENSTRUP00000032387 31033.ENSTRUP00000032387 ENSTRUP00000032387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]