SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000033728 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000033728
Domain Number 1 Region: 19-92
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000157
Family Cold shock DNA-binding domain-like 0.0025
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000033728
Domain Number - Region: 132-153
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000649
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000033728
Sequence length 240
Comment (Takifugu rubripes)
Sequence
SDGQGQEPAGLEGLPPMYSIAKGEVVSVQTYGAFVRLPGYKKEGLVHVSEMSASRVESAS
EIVDVGEKVWIKVIGREIRGDKVKLSFSMKAVNQGTGRDLDPNNVMAEQDARRRQQFRDH
TGNRITLEAVLNTTCSKCGCKGHFTKDCFSAPGLQYALLPEGGDEVPEQQTSTVKPQPDS
DKKKKKKKEKKKKRKRNRKDSESDGSSSECQSKRRHRDHSADRQDKKKKKHKKHKSHKHS
Download sequence
Identical sequences H2U9W2
ENSTRUP00000033728 31033.ENSTRUP00000033728 ENSTRUP00000033728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]