SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000034293 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000034293
Domain Number 1 Region: 28-149
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.26e-27
Family Eukaryotic type KH-domain (KH-domain type I) 0.00004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000034293
Sequence length 324
Comment (Takifugu rubripes)
Sequence
EIEKSQKDEGKEEEKFIDVVINKNMKLGQKVLIPVKQFPKFNFVGKLLGPRGNSLKRLQE
DTLTKMSILGKGSMRDKEKEEELRQSGEAKYHHLNEDLHVLIEVFAPPAEAYARMGHALE
EIKKFLIPDYNDEIRQAQLQELTYLNGGSEDAKVPSVRGKSAVRGRGTPAPGPPRCVRSR
GGVPPLHAAVPRGAAPRGAPPSRAPSSRGRGVQRARGAPPTAGYRPAPVVQRLRLEGVEA
APPAPLPRPQEYDDGYGTAYDEQYESYDNSYNNQGQNSDDYYEYGHSGESYDSYGVEEWA
NNRGKAPSARTTKGVYRDQPYSRY
Download sequence
Identical sequences H2UBH5
ENSTRUP00000034293 31033.ENSTRUP00000034293 ENSTRUP00000034293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]