SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000034762 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000034762
Domain Number 1 Region: 89-179
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.64e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.001
Further Details:      
 
Domain Number 2 Region: 276-349
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.38e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000452
Further Details:      
 
Domain Number 3 Region: 4-77
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000034762
Sequence length 358
Comment (Takifugu rubripes)
Sequence
SEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREDSGARINISEGNCPERIVTITGPT
DAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEMRE
STGAQVQVAGDMLPNSTERAVTISGTPEAIIQCVKQICVVMLEVTSQSPPKGATIPYRPK
PASTPVIFSGGQVTCQGCSSHPLPLPSVCLPPCVEVQLDAYTIQGQYAIPHPDLSKLHQL
AMQQTPFTPLGQTTPAFPEFSTSSTEQRIHWAAGLDASNQASTHELTIPNDLIGCIIGRQ
GTKINEIRQMSGAQIKIANAMEGSSERQITITGTPANISLAQYLINARGKREKTPGYL
Download sequence
Identical sequences H2UCU3
31033.ENSTRUP00000034762 ENSTRUP00000034762 ENSTRUP00000034762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]