SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000040013 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000040013
Domain Number 1 Region: 42-146
Classification Level Classification E-value
Superfamily POZ domain 5.69e-31
Family Tetramerization domain of potassium channels 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000040013
Sequence length 233
Comment (Takifugu rubripes)
Sequence
RAEPRAEETRSGMAESNSEASGSVHRRCAAHSQERNSSAGVSKWIRLNVGGTYFLTTRQT
LCRDPKSFLYRLSQADPELDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVLNKDLAEEG
VLEEAEFYNITSLIKLIKDKIRERDCKTSQVPVKHVYRVLQCQEEELTQMVSTMSDGWKF
EQLVSIGSSYNYGNEDQAEFLCVVSKELHNQSYGTNSEPSEKAKILQERGSRM
Download sequence
Identical sequences H2USU0
ENSTRUP00000040013 31033.ENSTRUP00000040013 ENSTRUP00000040013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]