SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000043538 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000043538
Domain Number 1 Region: 28-129
Classification Level Classification E-value
Superfamily POZ domain 1.96e-30
Family Tetramerization domain of potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000043538
Sequence length 227
Comment (Takifugu rubripes)
Sequence
NASESGGTTPQNVGNGSVINPAGGNNGKWVRLNVGGTVFLTTRQTLLKEQTSFLYRLCQQ
QDLHSDTDETGAYVIDRDPTYFGPILNYLRHGKLVYNKELAEEGVLEEAEFYNITPLIKL
IKDRIVERDSKATQQVPPKHVYRVLQCQEEELTQMVSTMSDGWKFEQMVNIGSSYSYGTE
DQAEFLCVVSKELHTAGSGLGTEQSHKTKPADTQEDEVTKDEEEEEE
Download sequence
Identical sequences H2V2V7
ENSTRUP00000043538 ENSTRUP00000043538 31033.ENSTRUP00000043538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]