SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000043838 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000043838
Domain Number 1 Region: 206-284
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000289
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 2 Region: 74-146
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000043838
Sequence length 334
Comment (Takifugu rubripes)
Sequence
MSEPTGMGVKPAPQGGVEMAAAMAAKINAMLMAKGKLMTPPPLLAKVPTPPSVPVPVITE
ELVVTEVDINDVPFNCRDLLTKGKTQEEIRQFSGAVVTTKGHFMAEIEKGGAGYGIQRPL
YLHVQGKNQEQVNKAVMRIKEIISEDLLRASAASGGKQIPIMPPLTLYPQPPRPVTPAAV
PRTPNATSVPGFVHTKIFVGLDQALQSFNVKDKVEGPGGSYLSHIQTETGARVFLRGKSS
GYIEQASKRESFEPLHVYISHPNAAGLEAAKKLTESLLETVRAEHAHMVSVYTATGSTQP
YPAHGLPPSNNYSNQGSWYDYPANGYAGGYAAYP
Download sequence
Identical sequences H2V3Q6
31033.ENSTRUP00000043838 ENSTRUP00000043838 ENSTRUP00000043838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]