SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000045598 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000045598
Domain Number 1 Region: 84-170
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 249-322
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 
Domain Number 3 Region: 3-73
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000045598
Sequence length 440
Comment (Takifugu rubripes)
Sequence
LNVTLTLRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGSSPERIVTITGATEAIF
RAFAMIAQKFEEDISAAMSNSSVTSKPPVTLRLVFPGSQCGSLIGKGGSKIKEIRETTGA
QVQVAGDMLPDSTERAVTISGTPQAITQCVRHICSVMLESPPKGATIPYRPKAVTVGVHA
VLAPQQSAHVSSPIKQIEEVLLLQAFAIPGQYTFAHQDLTKLHQLAMQHIPLPSLGQSNP
TFPDFAGLDPSAPTSSQEMAIPNDFIGCIIGRQGSKINEIRQVSGAHIKIASTTDGSAVR
QVTITGSPASINVAQYLINASLEMAKYTMQAASSATPVDLNLGFSQSAPTASTAATSMAV
LAAANPAPTTINVHSPSTLPAIQNPHYAIPVSSLLGMKSLPLLAVHPAAASSLTQGLSHY
TAKMPTSGVKKSERQKFAPY
Download sequence
Identical sequences H2V8Q9
31033.ENSTRUP00000045598 ENSTRUP00000045598 ENSTRUP00000045598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]