SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000046201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000046201
Domain Number 1 Region: 84-209
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.09e-34
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000454
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000046201
Sequence length 339
Comment (Takifugu rubripes)
Sequence
MVGETEVKERPKSNPDYLMQLMNDRKVMSSLPNFSGIFTHLERLLDEEIGRVRKDMYNDS
VNGGMFNGRDLEELPEAVGPVVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLESETG
CKIMVRGKGSMRDKKKEEMNRGKPNWEHLSEDLHVLITVEDTHNRAKIKLQRAINEVKKL
LVPAAEGEDNLKKVQLMELAILNGTYRDANVKTPAGAFTLGTPQAPRIITGPTPVLPPTL
RNPAPVTTPTLMPLIRQIQSSALVPGANPHPALVQQGPESGIIYTPYEYPYTLTPSILEY
PIDSTGVLAGAMTTKVRRHDKRIHPYQRVVTPDRGVFGR
Download sequence
Identical sequences H2VAG0
31033.ENSTRUP00000046201 ENSTRUP00000046201 ENSTRUP00000046201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]