SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 311402.Avi_9911 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  311402.Avi_9911
Domain Number 1 Region: 34-219
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.22e-21
Family Eukaryotic proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 311402.Avi_9911
Sequence length 262
Comment (Agrobacterium vitis S4)
Sequence
MLLMDTSLSSAWAEDAVYQSVETLNQSGLEGQVIHGTVPARTTDWPATLYANVDDHSHCT
ATIVGPHVILTAAHCLPPSGKFTAIVHQIAYHATCTKPDGWPNDPSDDYALCSTDGDAIP
VVYEMISFNPKAVALGVKITLAGYGCSDQYQNGAGTFRIGYAPVVRMPNVPDKTYVFDRN
SVVTQGAAICPGDSGGGAFLETPTAAGTYRAIVGVNSRVDMSKLTSYLSATFSPDGRAFF
QSWSKEKSAQICGLGAVQGCRN
Download sequence
Identical sequences B9JRL9
gi|222147544|ref|YP_002548501.1| 311402.Avi_9911 WP_015917606.1.42352 WP_015917606.1.44083 WP_015917606.1.73387 WP_015917606.1.78727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]