SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 311403.Arad_0150 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  311403.Arad_0150
Domain Number - Region: 11-72
Classification Level Classification E-value
Superfamily Proton glutamate symport protein 0.0114
Family Proton glutamate symport protein 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 311403.Arad_0150
Sequence length 78
Comment (Agrobacterium radiobacter K84)
Sequence
MPNGKLPKHYSAVVMPLILSLLMTSVVSAISILRSQGVTAEAFALWPSTWGISWAIAFPV
LLLLLPVVRRVTAAIVES
Download sequence
Identical sequences A0A061N1E7 A0A071ILE6 B9JGR9 J2DCF2
WP_007690331.1.25048 WP_007690331.1.39766 WP_007690331.1.44225 WP_007690331.1.44284 WP_007690331.1.49937 WP_007690331.1.55147 WP_007690331.1.56352 WP_007690331.1.78634 WP_007690331.1.85071 WP_007690331.1.88216 WP_007690331.1.91008 gi|222084311|ref|YP_002542840.1| 311403.Arad_0150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]