SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 311403.Arad_8650 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  311403.Arad_8650
Domain Number 1 Region: 149-220
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000136
Family CAP C-terminal domain-like 0.04
Further Details:      
 
Domain Number 2 Region: 11-131
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000668
Family cAMP-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 311403.Arad_8650
Sequence length 238
Comment (Agrobacterium radiobacter K84)
Sequence
MSPPKKSEIRNTLLRSLSDQDFDHIASHLEGIDLPKRFMITTPDRISDYIYFLESGIGSV
VVRAPEGKSAEIGVFGREGFSPTAVLQGSESAPFSIFMQVAGAGYRIQNARILAAASDRL
ELRNLLLRYVQAASIQTAYTAFSNAADQIEQRLARWLLMCHDRTDGDKIDLTHDFLAVML
AVRRQSVTTTLHVLEGKHLIVSQRGFVAIRDRVGLEALAGSSYGVPEREYRRLISQTG
Download sequence
Identical sequences A0A061N1C2 A0A071HUY8 B9JIX8 J2L951
gi|222082102|ref|YP_002541467.1| 311403.Arad_8650 WP_007694380.1.25048 WP_007694380.1.39766 WP_007694380.1.44225 WP_007694380.1.44284 WP_007694380.1.55147 WP_007694380.1.56352 WP_007694380.1.78634 WP_007694380.1.85071 WP_007694380.1.88216 WP_007694380.1.91008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]