SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 312153.Pnuc_1055 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312153.Pnuc_1055
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-50
Family Ribonuclease PH domain 1-like 0.0000143
Further Details:      
 
Domain Number 2 Region: 295-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.32e-49
Family Ribonuclease PH domain 1-like 0.0000152
Further Details:      
 
Domain Number 3 Region: 147-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.26e-28
Family Ribonuclease PH domain 2-like 0.00099
Further Details:      
 
Domain Number 4 Region: 451-549
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.77e-28
Family Ribonuclease PH domain 2-like 0.00012
Further Details:      
 
Domain Number 5 Region: 556-641
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.02e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 6 Region: 241-322
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 7.06e-19
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0061
Further Details:      
 
Domain Number 7 Region: 621-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.56e-18
Family Cold shock DNA-binding domain-like 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 312153.Pnuc_1055
Sequence length 722
Comment (Polynucleobacter necessarius asymbioticus QLW P1DMWA 1)
Sequence
MTMFKKAVKSFQWGNHQVTMETGEIARQSGGAVIVNVDDTVVMGTVVASKSAKPGQSFFP
LTVDYLEKTYAAGKIPGGFFRREGRPSEGETLISRLIDRPLRPLFPEGFLNEVQVVIHVL
SINPDVPSDIPALIAASAALAISGIPFAGPVGAARVGYANGQYLLNPTRTEQATSELDLI
VAGTQAAVLMVESEANQLSEEVMLGAVVYGHDQMQTAINAINELVAEAGKPEWDWTAAPK
DEPFIAKVTALAEAPLREAYQIRQKGARSDKLKEITKEVMAKLQEEGDVDAVAVNDILFE
IEAKIVRSQILNGEPRIDGRDTRTVRPIEIRNGVLPRTHGSALFTRGETQALVVATLGTA
RDEQIIDALEGEYRDRFMFHYNMPPFATGETGRVGSPKRREIGHGRLAKRALIPVLPSAE
DFAYSIRVVSEITESNGSSSMASVCGGCLAMMDAGVPVKAHVAGVAMGLILDGNRFAVLT
DILGDEDHLGDMDFKVAGTANGITALQMDIKVQGITKEIMQVALAQAKEGRLHILSKMQE
AMGSVRTELSAHAPRMVSFKIHPDKIREVIGKGGATIQALTKETGCSIDIKDDGTVTIAS
TSAEGMAEAKARIEGITAEAEVGKIYEGPVVKLLEFGALVNILPGKDGLLHISEISNERV
KEVKDYLAEGQVVRVKLLAADERGRLRLSLKAAMADEGGTIAPLAGAAEVVAEEAPASGE
SA
Download sequence
Identical sequences A4SXQ7
gi|145589238|ref|YP_001155835.1| 312153.Pnuc_1055 WP_011902896.1.22821 WP_011902896.1.31131 WP_011902896.1.54276 WP_011902896.1.78143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]