SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 312153.Pnuc_1278 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  312153.Pnuc_1278
Domain Number - Region: 22-150
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.001
Family Voltage-gated potassium channels 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 312153.Pnuc_1278
Sequence length 171
Comment (Polynucleobacter necessarius asymbioticus QLW P1DMWA 1)
Sequence
MLIPPESISQTAVLGLPIMPLIVEVFFGILGLILVLMYHGVAINHIIMRFEKQANKHLRL
GRYNYVFMHFYASFFFIALMHICEIIIWCFFITGLGLMDDSVHALLFAGSCYTTVGFVPD
TLPMGWKSLAFFISFSGLFCLAWTTSVMIGMTNTYKNAWNLKYGQKDLSSS
Download sequence
Identical sequences A4SYC8
WP_011903117.1.22821 WP_011903117.1.31131 WP_011903117.1.54276 WP_011903117.1.58031 WP_011903117.1.63010 WP_011903117.1.78143 312153.Pnuc_1278 gi|145589459|ref|YP_001156056.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]