SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 312153.Pnuc_1653 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312153.Pnuc_1653
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily MAPEG domain-like 6.02e-37
Family MAPEG domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 312153.Pnuc_1653
Sequence length 134
Comment (Polynucleobacter necessarius asymbioticus QLW P1DMWA 1)
Sequence
MNQYIYASFITLMTVLLMMGLLFNVGRARGKYKVQAPATSGNEMFERAYRIQLNTIENVL
LFLPALWLYAIFIGDKGAGDSGVIWLIARVWYAISYQLNPAKRGLGFLISLLVIAGLWTG
AAYGIFTQFTKVSI
Download sequence
Identical sequences A4SZF2
WP_011903489.1.22821 WP_011903489.1.27397 WP_011903489.1.31131 WP_011903489.1.54276 WP_011903489.1.58031 WP_011903489.1.63010 WP_011903489.1.78143 312153.Pnuc_1653 gi|145589833|ref|YP_001156430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]