SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 312309.VF_0490 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  312309.VF_0490
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.18e-48
Family Ribonuclease PH domain 1-like 0.0000148
Further Details:      
 
Domain Number 2 Region: 291-489
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-46
Family Ribonuclease PH domain 1-like 0.0000197
Further Details:      
 
Domain Number 3 Region: 146-236
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 4.07e-29
Family Ribonuclease PH domain 2-like 0.00088
Further Details:      
 
Domain Number 4 Region: 451-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.8e-28
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 5 Region: 555-640
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.48e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 
Domain Number 6 Region: 621-695
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.95e-21
Family Cold shock DNA-binding domain-like 0.0000728
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 312309.VF_0490
Sequence length 709
Comment (Vibrio fischeri ES114)
Sequence
MFANPVVKSFQYGNHTVTLETGVIARQATAAVMASMDDTSVFVSVVAKKEAVPGQDFFPL
TVNYQERTYAAGKIPGGFFKREGRPSEAETLTARLIDRPIRPLFPDAFKNEVQVIATVVS
INPEVNPDMITMIGTSAALAIAGIPFNGPIGAARVGHINGELVLNPSNTELENSKLDLVV
SGTEGAVLMVESEADNLTEEEMLSAVVFGHEQQQVVINAINEFAAEVATPAWDWVAPEEN
TVLNARIAELAEAKLVEAYQITEKMTRYDRIHEIAAEVNEVLVSENEDVNLKEVHTIFHD
LEKTVVRRSIIAGNPRIDGREKDMVRALDVRTGVLPRTHGSSLFTRGETQALVTATLGTQ
RDAQIIDSLMGEKKDHFLLHYNFPPYCVGETGFVGSPKRREIGHGKLAKRGIQAVMPSIE
EFPYTVRVVSEITESNGSSSMASVCGTSLALMDAGVPIKASVAGIAMGLVKEGDDFVVLS
DILGDEDHLGDMDFKVAGTNEGITALQMDIKIEGITKEIMQIALNQAQGARKHILKVMDE
AISGAREEISEFAPRIHTMKISSDKIKDVIGKGGAVIRALCEETGTTIEIEDDGTIKIAA
TEGAAAKEAIRRIEEITAEVEVGKIYTGKVMRIVDFGAFVTVLGPKEGLVHISQIAEERI
EKVADHLQVGQEVKTKVLEIDRQGRIRLSIKEANAELNPAPAAEAKDAE
Download sequence
Identical sequences Q5E7L1
WP_011261261.1.100783 WP_011261261.1.102040 WP_011261261.1.21775 WP_011261261.1.21836 WP_011261261.1.23113 WP_011261261.1.34959 WP_011261261.1.66091 WP_011261261.1.76652 WP_011261261.1.77059 WP_011261261.1.82276 WP_011261261.1.94618 YP_203873.1.56684 312309.VF_0490 gi|59711097|ref|YP_203873.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]