SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE00456 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE00456
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily POZ domain 5.49e-17
Family Tetramerization domain of potassium channels 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE00456
Sequence length 146
Comment (Caenorhabditis remanei)
Sequence
MTDTLIIRFNVGGTPMATLKTTFPVDSIFHKWFVSRTKASPFTSDRDGAYFVDRDPFSFG
IVLNYFRLRKAGQLWEACLPKDPDRLAMLTQEADFFLLPQLRDQAICMLQLCSNKNDSNY
INEMLAKSTSCPQGFEKKEEEDEEDF
Download sequence
Identical sequences A0A261CQD3 E3LCS3
31234.CRE00456 CRE00456 XP_003117681.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]