SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE01824 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE01824
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.94e-37
Family Calponin-homology domain, CH-domain 0.0000173
Further Details:      
 
Domain Number 2 Region: 215-278
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000000497
Family EB1 dimerisation domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE01824
Sequence length 302
Comment (Caenorhabditis remanei)
Sequence
MVVNVFISAVTTDTLSRKDAVAWVNNLLKFQSHFTKVEEMANGAAYCQLTHLLFSNSINL
RKVKFNPRSEPDILTNWKVLTTSWKDLGIDKPVDVEKMKKGKFQDNMEFLQWFYKFFKAN
LNVEPEDYDAVGSRFGEDLPALKGASGPRPAVASVRPVVAQTMKTKTTMQPVAPVPATKA
AVAPTVRNGARPAPATSAGNRRSETSPNEELLKQEIEKQKTLAAEWETMAKDMESEREFY
YNMLQRVEALVHEADELKATTIEVETLKKVLYDGNEETVENGDDNSQLNEALNANIDDTD
TF
Download sequence
Identical sequences 31234.CRE01824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]