SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31234.CRE02825 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31234.CRE02825
Domain Number 1 Region: 92-163
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.57e-24
Family Skp1 dimerisation domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily POZ domain 1.06e-16
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31234.CRE02825
Sequence length 177
Comment (Caenorhabditis remanei)
Sequence
MTDEPMEPVKYFKLESKENTELKISALAAEQSGLLSKMVKHLDLSADYENMEPIPITNIS
EKTLVKVIEWCEKHKEDPMLEDRLPDPPVVVIPDWDQEFLQIDNVELFDLIVAVNYLNIQ
RLMNYACKKVALMGKGKSPEELRVIFGIPTDEEDAEMERAAAEKIKAEREAAAVNSH
Download sequence
Identical sequences E3LX70
XP_003111833.1.11157 CRE02825 31234.CRE02825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]